PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g020070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 214aa    MW: 24867.4 Da    PI: 9.4949
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g020070.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.72.6e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien+ nrqvt+skRrngi+KKA+E+ vLC+a+v++iif+s+gk++ey+s
  Sopen06g020070.1  9 KRIENTNNRQVTYSKRRNGIIKKAKEITVLCEAKVSLIIFASSGKMHEYCS 59
                      79***********************************************96 PP

2K-box77.43.6e-2671168198
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       yqk+sg++l++ak+e+l++e++++kke++++q ++Rhl+Ged+++L++keL  +e++L+++l++i +k++e+l++  ++ q  e+e+++ + a
  Sopen06g020070.1  71 YQKASGRRLWDAKHENLSNEIDRIKKENDSMQVKLRHLKGEDINQLTHKELIIMEEALQNGLSSISAKQSEILRMVRKNDQILEEENKQLQYA 163
                       8999***************************************************************************************** PP

             K-box  94 Lrkkl 98 
                       L++k 
  Sopen06g020070.1 164 LHQKE 168
                       **996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.847161IPR002100Transcription factor, MADS-box
CDDcd002654.12E-39280No hitNo description
SuperFamilySSF554555.89E-35296IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-1682163IPR002487Transcription factor, K-box
PROSITE profilePS5129713.71484170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MGRGKIEIKR IENTNNRQVT YSKRRNGIIK KAKEITVLCE AKVSLIIFAS SGKMHEYCSP  60
STTISDMLDG YQKASGRRLW DAKHENLSNE IDRIKKENDS MQVKLRHLKG EDINQLTHKE  120
LIIMEEALQN GLSSISAKQS EILRMVRKND QILEEENKQL QYALHQKEMG AIGGSGNMRG  180
IHEEVYHQRE RDYEYQMPFG LRVQPMQPNL HERM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S3e-15159159Myocyte-specific enhancer factor 2B
1tqe_R3e-15159159Myocyte-specific enhancer factor 2B
1tqe_Q3e-15159159Myocyte-specific enhancer factor 2B
1tqe_P3e-15159159Myocyte-specific enhancer factor 2B
3p57_J3e-15289180Myocyte-specific enhancer factor 2A
3p57_I3e-15289180Myocyte-specific enhancer factor 2A
3p57_D3e-15289180Myocyte-specific enhancer factor 2A
3p57_C3e-15289180Myocyte-specific enhancer factor 2A
3p57_B3e-15289180Myocyte-specific enhancer factor 2A
3p57_A3e-15289180Myocyte-specific enhancer factor 2A
3kov_J3e-15289180Myocyte-specific enhancer factor 2A
3kov_I3e-15289180Myocyte-specific enhancer factor 2A
3kov_B3e-15289180Myocyte-specific enhancer factor 2A
3kov_A3e-15289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ6745310.0DQ674531.1 Lycopersicon esculentum TPI mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234075.21e-158TPI
RefseqXP_015078786.11e-158PREDICTED: floral homeotic protein PMADS 2
SwissprotQ074741e-137MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLK4C6I11e-158K4C6I1_SOLLC; Uncharacterized protein
STRINGSolyc06g059970.2.11e-158(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46802139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.19e-87MIKC_MADS family protein